PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA09g05110
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family WRKY
Protein Properties Length: 188aa    MW: 21161.8 Da    PI: 8.2826
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA09g05110genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.64.5e-322480258
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
        WRKY  2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58
                dDgy+WrKYGqK++k+s++prsYY+Ct ++C +kk+vers+++p++++itYeg H h
  CA09g05110 24 DDGYKWRKYGQKSIKNSPYPRSYYKCTNPRCGAKKQVERSSNEPDTFIITYEGLHLH 80
                8******************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081127.3931883IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.0E-301880IPR003657WRKY domain
SuperFamilySSF1182904.32E-272080IPR003657WRKY domain
SMARTSM007743.9E-352382IPR003657WRKY domain
PfamPF031065.1E-262480IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MNKQEALENK YTLRIKTCGN AMADDGYKWR KYGQKSIKNS PYPRSYYKCT NPRCGAKKQV  60
ERSSNEPDTF IITYEGLHLH FAYPFITLNP PQFLDQPTKK PKLTNPKAQN NEENASEIDE  120
SPKFVNPSPI VDLEDGLGFG EMGSQGLLED MVPLMIRNPF IKPTNSYSSS CSYSSPPTSP  180
SFSWSNN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A9e-2422801674Probable WRKY transcription factor 4
2lex_A9e-2422801674Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-84HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016541395.11e-138PREDICTED: probable WRKY transcription factor 49
SwissprotQ9FHR78e-41WRK49_ARATH; Probable WRKY transcription factor 49
TrEMBLK4CRC25e-92K4CRC2_SOLLC; Uncharacterized protein
STRINGSolyc09g010960.2.12e-91(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA120752124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.14e-42WRKY DNA-binding protein 49